Category Archives: How To

How to do things. doh.

Storing your stuff with clever filesystems: ZFS and tmpfs

The filesystem is a a critical component of just about any operating system, however it’s often overlooked. When setting up a new server, the default filesystem options are often ticked and never thought about again. However, there exist a couple of filesystems which can provide some extraordinary features and speed. I’m talking about ZFS and tmpfs.

ZFS was originally developed by Oracle for their Solaris operating system, but has now been open-sourced and is freely available on linux. Tmpfs is a temporary file system which uses system memory to provide fast temporary storage for files. Together, they can provide outstanding reliability and speed for not very much effort.

Hard disk capacity has increased exponentially over the last 50 years. In the 1960s, you could rent a 5MB hard disk from IBM for the equivalent of $130,000 per month. Today you can buy for less than $600 a 12TB disk – a 2,400,000 times increase.

As storage technology has moved on, the filesystems which sit on top of them ideally need to be able to access the full capacity of those ever increasing disks. Many relatively new, or at least in-use, filesystems have serious limitations. Akin to “640K ought to be enough for anybody”, the likes of the FAT32 filesystem supports files which are at most 4GB on a chunk of disk (a partition) which can be at most 16TB. Bear in mind that arrays of disks can provide a working capacity of many times that of a single disk. You can buy the likes of a supermicro sc946ed shelf which will add 90 disks to your server. In an ideal world, as you buy bigger disks you should be able to pile them into your computer and tell your existing filesystem to make use of them, your filesystem should grow and you won’t have to remember a different drive letter or path depending on the hardware you’re using.

ZFS is a 128-bit file system, which means a single installation maxes out at 256 quadrillion zettabytes. All metadata is allocated dynamically so there isn’t the need to pre-allocate inodes and directories can have up to 2^48 (256 trillion) entries. ZFS provides the concept of “vdevs” (virtual devices) which can be a single disk or redundant/striped collections of multiple disks. These can be dynamically added to a pool of vdevs of the same type and your storage will grow onto the fresh hardware.

A further consideration is that both disks of the “spinning rust” variety and SSDs are subject to silent data corruption, i.e. “bit rot”. This can be caused by a number of factors even including cosmic rays, but the consequence is read errors when it comes time to retrieve your data. Manufacturers are aware of this and buried in the small print for your hard disk will be values for “unrecoverable read errors” i.e. data loss. ZFS works around this by providing several mechanisms:

  • Checksums for each block of data written.
  • Checksums for each pointer to data.
  • Scrub – Automatically validates checksums when the system is idle.
  • Multiple copies – Even if you have a single disk, it’s possible to provide redundancy by setting a copies=n variable during filesystem creation.
  • Self-healing – When a bad data block is detected, ZFS fetches the correct data from a redundant copy and replaces it with the correct data.

An additional bonus to ZFS is its ability to de-duplicate data. Should you be working with a number of very similar files, on a normal filesystem, each file will take up space proportional to the amount of data that’s contained. As ZFS keeps checksums of each block of data, it’s able to determine if two blocks contain identical data. ZFS therefore provides the ability to have multiple pointers to the same file and only store the differences between them.

 

ZFS also provides the ability to take a point in time snapshot of the entire filesystem and roll it back to a previous time. If you’re a software developer, got a package that has 101 dependencies and you need to upgrade it? Afraid to upgrade it in case it breaks things horribly? Working on code and you want to roll back to a previous version? ZFS snapshots can be run with cron or manually and provide a version of the filesystem which can be used to extract previous versions of overwritten or deleted files or used to roll everything back to a point in time when it worked.

Similar to deduplication, a snapshot won’t take up any disk extra space until the data starts to change.

The other filesystem worth mentioning is tmpfs. Tmpfs takes part of the system memory and turns it into a usable filesystem. This is incredibly useful for systems which create huge numbers of temporary files and attempt to re-read them. Tmpfs is also just about as fast as a filesystem can be. Compared to a single SSD or a RAID array of six disks, tmpfs blows them out of the water speed wise.

Creating a tmpfs filesystem is simple:
First create your mountpoint for the disk:

mkdir /mnt/ramdisk

Then mount it. The options are saying make it 1GB in size, it’s of type tmpfs and to mount it at the previously created mount point:

mount –t tmpfs -o size=1024m tmpfs /mnt/ramdisk

At this point, you can use it like any other filesystem:

df -h
Filesystem Size Used Avail Use% Mounted on
/dev/sda1  218G 128G   80G  62% /
/dev/sdb1  6.3T 2.4T  3.6T  40% /spinnyrust
tank       946G 3.5G  942G   1% /tank
tmpfs      1.0G 391M  634M  39% /mnt/ramdisk

How to parse OAS data

We have recently released the Observed Antibody Space database – collection of cleaned and annotated antibody sequence (Ig-seq or AIRR-seq) data from 53 studies. We have formatted the data in the format that should facilitate data mining and since release we had several queries on how to parse the data out. Therefore here we give a small example of how to parse the data and make sense of it.

You should download the bulk data file from OAS, available here.

The datasets are separated into ‘data units‘  – collections of sequences that can be uniquely assigned to a range of metadata parameters such as study, organism etc. Our task therefore is to iterate through all those files and read sequences from each of these. Firstly we will attempt to iterate through the files and I will assume that you uncompressed the bulk data file into ../data/json folder. We will write a helper function that will simply list all files with its full paths in a directory and call it list_file_paths

import os

#Fetch all files in directory and subdirectories.
def list_file_paths(directory):
   for dirpath,_,filenames in os.walk(directory):
       for f in filenames:
           yield os.path.abspath(os.path.join(dirpath, f))

if __name__ == '__main__':
    #Replace this with the location of where you uncompressed the bulk data file.
    directory = '../data/json'

    for f in list_file_paths(directory):
        print f

The code above will list all the files in ../data/json which incidentally are all the ‘data units’. Now our task is to parse out the output from each of the data units. They are gzipped files with data element on each line. Therefore we will use gzip library to stream the contents of a gzipped file rather than uncompressing each one of them separately. This is achieved by function parse_single_file

import os,gzip

#Fetch all files in directory and subdirectories.
def list_file_paths(directory):
   for dirpath,_,filenames in os.walk(directory):
       for f in filenames:
           yield os.path.abspath(os.path.join(dirpath, f))

#Parse out the contents of a single file.
def parse_single_file(src):
    #The first line are the meta entries.
    meta_line = True
    for line in gzip.open(src,'rb'):
        print line
    

if __name__ == '__main__':
    #Replace this with the location of where you uncompressed the bulk data file.
    directory = '../data/json'

    for f in list_file_paths(directory):
        parse_single_file(f)

The code above will simply go through all the data unit files, stream the gzipped lines and print each one of them separately. Each line however is formatted as json – meaning it can be parsed using pythons json library and act as a pythonic dictionary. below we have parsed out the basic elements in the final incarnation of the code:

import os,gzip,json,pprint

#Fetch all files in directory and subdirectories.
def list_file_paths(directory):
   for dirpath,_,filenames in os.walk(directory):
       for f in filenames:
           yield os.path.abspath(os.path.join(dirpath, f))

#Parse out the contents of a single file.
def parse_single_file(src):
    #The first line are the meta entries.
    meta_line = True
    for line in gzip.open(src,'rb'):
        if meta_line == True:
                metadata = json.loads(line)
                meta_line=False
                print "Metadata:"
                pprint.pprint(metadata)
                continue
        #Parse actual sequence data.
        basic_data = json.loads(line)
        print "Basic data:"
        pprint.pprint(basic_data)

        #IMGT-Numbered sequence.
        print "IMGT-numbered sequence"
        d = json.loads(basic_data['data'])
        pprint.pprint(d)
        print "==========="
    
if __name__ == '__main__':
    #Replace this with the location of where you uncompressed the bulk data file.
    directory = '../data/json'

    for f in list_file_paths(directory):
        parse_single_file(f)

The first line of each data unit are meta entries. These look as follows:

{u'Age': u'22-70',
 u'Author': u'Halliley et al., (2015)',
 u'BSource': u'Bone-Marrow',
 u'BType': u'Plasma-B-Cells',
 u'Chain': u'Heavy',
 u'Disease': u'None',
 u'Isotype': u'IGHM',
 u'Link': u'https://doi.org/10.1016/j.immuni.2015.06.016',
 u'Longitudinal': u'no',
 u'Size': 934,
 u'Species': u'human',
 u'Subject': u'no',
 u'Vaccine': u'Tetanus/Flu'}

The attributes should be self-explanatory and the existence of this data on top of each file is supposed to streamline searching through data-units if you wish to parse sequences given a particular configuration of meta-data entries (e.g. organism).

Next, the code parses out data on each sequence that is associated with its genes, full sequence, CDR3 and numbered sequence. Therefore the output for this will look something like this:

{u'cdr3': u'ARHQGVYWVTTAGLSH',
 u'data': u'{"fwh1": {"11": "G", "24": "T", "13": "V", "12": "L", "15": "P", "14": "K", "17": "E", "16": "S", "19": "L", "18": "T", "22": "T", "26": "S", "25": "V", "21": "L", "20": "S", "23": "C"}, "fwh3": {"68": "N", "88": "S", "89": "L", "66": "Y", "67": "Y", "82": "T", "83": "S", "80": "V", "81": "D", "86": "Q", "87": "F", "84": "K", "85": "N", "92": "S", "79": "S", "69": "P", "104": "C", "78": "I", "77": "T", "76": "V", "75": "R", "74": "S", "72": "K", "71": "L", "70": "S", "102": "Y", "90": "K", "100": "A", "101": "V", "95": "T", "94": "V", "97": "A", "96": "A", "91": "L", "99": "T", "98": "D", "93": "S", "103": "Y"}, "fwh2": {"52": "W", "39": "W", "48": "Q", "49": "G", "46": "P", "47": "G", "44": "Q", "45": "P", "51": "E", "43": "R", "40": "G", "42": "I", "55": "S", "53": "I", "54": "G", "41": "W", "50": "L"}, "fwh4": {"120": "Q", "121": "G", "122": "T", "123": "L", "124": "V", "125": "P", "126": "V", "127": "S", "128": "S", "119": "G", "118": "W"}, "cdrh1": {"27": "G", "37": "Y", "31": "S", "30": "I", "28": "G", "29": "S", "35": "S", "34": "S", "38": "Y", "36": "S"}, "cdrh2": {"59": "S", "58": "Y", "57": "S", "56": "I", "63": "G", "64": "T", "65": "T"}, "cdrh3": {"111A": "W", "109": "G", "108": "Q", "115": "L", "114": "G", "117": "H", "116": "S", "111": "Y", "110": "V", "113": "A", "112": "T", "112A": "T", "112B": "V", "106": "R", "107": "H", "105": "A"}}',
 u'j': u'IGHJ1*01',
 u'name': 12,
 u'redundancy': 1,
 u'seq': u'GLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGQGLEWIGSISYSGTTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARHQGVYWVTTAGLSHWGQGTLVPVSS',
 u'v': u'IGHV4-39*07'}

Above, redundancy refers to how many times we see a given sequence (seq) in a particular study. We also store the IMGT-numbered data (the data attribute) which needs a second round of json parsing and its output is a dictionary of IMGT-number – amino acid associations grouped by the regions of an antibody (cdrs and framework regions):

{u'cdrh1': {u'27': u'G',
            u'28': u'G',
            u'29': u'S',
            u'30': u'I',
            u'31': u'S',
            u'34': u'S',
            u'35': u'S',
            u'36': u'S',
            u'37': u'Y',
            u'38': u'Y'},
 u'cdrh2': {u'56': u'I',
            u'57': u'S',
            u'58': u'Y',
            u'59': u'S',
            u'63': u'G',
            u'64': u'T',
            u'65': u'T'},
 u'cdrh3': {u'105': u'A',
            u'106': u'R',
            u'107': u'H',
            u'108': u'Q',
            u'109': u'G',
            u'110': u'V',
            u'111': u'Y',
            u'111A': u'W',
            u'112': u'T',
            u'112A': u'T',
            u'112B': u'V',
            u'113': u'A',
            u'114': u'G',
            u'115': u'L',
            u'116': u'S',
            u'117': u'H'},
 u'fwh1': {u'11': u'G',
           u'12': u'L',
           u'13': u'V',
           u'14': u'K',
           u'15': u'P',
           u'16': u'S',
           u'17': u'E',
           u'18': u'T',
           u'19': u'L',
           u'20': u'S',
           u'21': u'L',
           u'22': u'T',
           u'23': u'C',
           u'24': u'T',
           u'25': u'V',
           u'26': u'S'},
 u'fwh2': {u'39': u'W',
           u'40': u'G',
           u'41': u'W',
           u'42': u'I',
           u'43': u'R',
           u'44': u'Q',
           u'45': u'P',
           u'46': u'P',
           u'47': u'G',
           u'48': u'Q',
           u'49': u'G',
           u'50': u'L',
           u'51': u'E',
           u'52': u'W',
           u'53': u'I',
           u'54': u'G',
           u'55': u'S'},
 u'fwh3': {u'100': u'A',
           u'101': u'V',
           u'102': u'Y',
           u'103': u'Y',
           u'104': u'C',
           u'66': u'Y',
           u'67': u'Y',
           u'68': u'N',
           u'69': u'P',
           u'70': u'S',
           u'71': u'L',
           u'72': u'K',
           u'74': u'S',
           u'75': u'R',
           u'76': u'V',
           u'77': u'T',
           u'78': u'I',
           u'79': u'S',
           u'80': u'V',
           u'81': u'D',
           u'82': u'T',
           u'83': u'S',
           u'84': u'K',
           u'85': u'N',
           u'86': u'Q',
           u'87': u'F',
           u'88': u'S',
           u'89': u'L',
           u'90': u'K',
           u'91': u'L',
           u'92': u'S',
           u'93': u'S',
           u'94': u'V',
           u'95': u'T',
           u'96': u'A',
           u'97': u'A',
           u'98': u'D',
           u'99': u'T'},
 u'fwh4': {u'118': u'W',
           u'119': u'G',
           u'120': u'Q',
           u'121': u'G',
           u'122': u'T',
           u'123': u'L',
           u'124': u'V',
           u'125': u'P',
           u'126': u'V',
           u'127': u'S',
           u'128': u'S'}}

We hope this quick intro to our data format will allow you to do great science with this data.

Working with Jupyter notebook on a remote server

To celebrate the recent beta release of Jupyter Lab (try it out of you haven’t already), today we’re going to look at how to run a Jupyter session (Notebook or Lab) on a remote server.

Suppose you have lots of data which lives on a remote server and you want to play with it in a Jupyter notebook. You can’t copy the data to your local machine (well, you can, but you’re sensible so you won’t), but you can run your Jupyter session on the remote server. There’s just one problem – since Jupyter notebook is browser-based and works by connecting to the Jupyter session running locally, you can’t just run Jupyter remotely and forward X11 like you would a traditional graphical IDE. Fortunately, the solution is simple: we run Jupyter remotely, create an ssh tunnel connecting a local port to the one used by the Jupyter session, and connect directly to the Jupyter session using our local browser. The best part about this is that you can set up the Jupyter session once then connect to it from any browser on any machine once an ssh tunnel is created, without worrying about X11 forwarding.

Here’s how to do it.

1. First, connect to the remote server if you haven’t already

ssh fergus@funkyserver

1.5. Jupyter takes browser security very seriously, so in order to access a remote session from a local browser we need to set up a password associated with the remote Jupyter session. This is stored in jupyter_notebook_config.py which by default lives in ~/.jupyter. You can edit this manually, but the easiest option is to set the password by running Jupyter with the password argument:

jupyter notebook password
>>> Enter password:

This password will be used to access any Jupyter session running from this installation, so pick something sensible. You can set a new password at any time on the remote server in exactly the same way.

2: Launch a Jupyter session on the remote server. You can specify the access port using the --port option. This might be useful on a shared server where others might be doing the same thing. You’ll also want to run this without launching a browser on the remote server since this is of no use to you.

jupyter lab --port=9000 --no-browser &

Here I’m using Jupyter Lab, but this works in exactly the same way for Jupyter Notebook.

3: Now for the fun part. Jupyter is running on our remote server, but what we really want is to work in our favourite browser on our local machine. To do this we just need to create an ssh tunnel between a port on our machine and the port our Jupyter session is using on the remote server. On our local machine:

ssh -N -f -L 8888:localhost:9000 fergus@funkyserver

For those not familiar with ssh tunneling, we’ve just created a secure, encrypted connection between port 8888 on our local machine and port 9000 on our remote server.

  • -N tells ssh we won’t be running any remote processes using the connection. This is useful for situations like this where all we want to do is port forwarding.
  • -f runs ssh in the background, so we don’t need to keep a terminal session running just for the tunnel.
  • -L specifies that we’ll be forwarding a local port to a remote address and port. In this case, we’re forwarding port 8888 on our machine to port 9000 on the remote server. The name ‘localhost’ just means ‘this computer’. If you’re a Java programmer who lives for verbosity, you could equivalently pass -L localhost:8888:localhost:9000.

4: If you’ve done everything correctly, you should now be able to access your Jupyter session via port 8888 on your machine. Fire up your favourite browser and type localhost:8888 into the address bar. This should bring up a Jupyter session and prompt you for a password. Enter the password you specified for Jupyter on the remote server.

Congratulations! You now have a Jupyter session running remotely which you can connect to anytime, anywhere, from any machine.

Disclaimer: I haven’t tried this on Windows, nor do I intend to. I value my sanity.

Dealing with indexes when processing co-evolution signals (or how to navigate through “sequence hell”)

Co-evolution techniques provide a powerful way to extract structural information from the wealth of protein sequence data that we now have available. These techniques are predicated upon the notion that residues that share spatial proximity in a protein structure will mutate in a correlated fashion (co-evolve). This co-evolution signal can be inferred from a multiple sequence alignment, which tells us a bit about the evolutionary history of a particular protein family. If you want to have a better gauge at the power of co-evolution, you can refer to some of our previous posts (post1, post2).

This is more of a practical post, where I hope to illustrate an indexing problem (and how to circumvent it) that one commonly encounters when dealing with co-evolution signals.

Most of the co-evolution tools available Today output pairs of residues (i,j) that were predicted to be co-evolving from a multiple sequence alignment. One of the main applications of these techniques is to predict protein contacts, that is pairs of residues that are within a predetermined distance (quite often 8Å).  Say you want to compare the precision of different co-evolution methods for a particular test set. Your test set would consist of a number of proteins for which the structure is known and for which sufficient sequence information is available for the contact prediction to be carried out. Great!

So you start with your target sequences, generate a number of contact predictions of the form (i,j) for each sequence and, for each pair, you check if the ith and jth residues are in contact (say, less than 8Å apart) on the corresponding known protein structure. If you actually carry out this test, you will obtain appalling precision for a large number of test cases. This is due to an index disparity that a friend of mine quite aptly described as “sequence hell”.

This indexing disparity occurs because there is a mismatch between the protein sequence that was used to produce the contact predictions and the sequence of residues that are represented in a protein structure. Ask a crystallographer friend if you have one, and you will find that in the process of resolving a protein’s structure experimentally, there are many reasons why residues would be missing in the final structure. More so, there are even cases where residues had to be added to enable protein expression and/or crystallisation. This implies that the protein sequence (represented by a fasta file) frequently has more (and sometimes fewer) residues than the proteins structure (represented by a PDB file).  This means that if the ith  and jth residues in your sequence were predicted to be in contact, that does not mean that they correspond to the ith and jth residues in order of appearance in your protein structure. So what do we do now?

A true believer in the purity and innocence of the world would assume that the SEQRES entries in your PDB file, for instance, would come to the rescue. The SEQRES describes the sequence of residues exactly as they appear on the atom coordinates of a particular PDB file. This would be a great way of mitigating the effects of added or altered residues, and would potentially mitigate the effects of residues that were not present in the construct. In other words, the sequences described by SEQRES would be a good candidate to validate whether your predicted contacts are present in the structure. They do, however, contain one limitation. SEQRES also describe any residues whose coordinates were missing in the PDB. This means that if you process the PDB sequentially and that some residues could not be resolved, the ith residue to appear on the PDB could be different to the ith residue in the SEQRES.

An even more innocent person, shielded from all the ugliness of the the universe, would simply hope that the indexing on the PDB is correct, i.e. that one can use the residue indexes presented on the “6th column” of the ATOM entries and that these would match perfectly to the (i,j) pair you obtained using your protein sequence. While, in theory, I believe this should be the case, in my experience this indexing is often incorrect and more frequently than not, will lead to errors when validating protein contacts.

My solution to the indexing problem is to parse the PDB sequentially and extract the sequence of all the residues for which coordinates are actually present. To my knowledge, this is the only true and tested way of obtaining this information. If you do that, you will be armed with a sequence and indexing that correctly represent the indexing of your PDB. From now on, I will refer to these as the PDB-sequence and PDB-sequence indexing.

All that is left is to find a correspondence (a mapping) between the sequence you used for the contact prediction and the PDB-sequence. I do that by performing a standard (global) sequence alignment using the Needleman–Wunsch algorithm. Once in possession of such an alignment, the indexes (i,j) of your original sequence can be matched to adjusted indexes (i',j') on your PDB-sequence indexing. In short, you extracted a sequential list of residues as they appeared on the PDB, aligned these to the original protein sequence, and created a new set of residue pairings of the form (i',j') which are representative of the indexing in PDB-sequence space. That means that the i’th residue to appear on the PDB was predicted to be in contact with the j’th residue to appear.

The problem becomes a little more interesting when you hope to validate the contact predictions for other proteins with known structure in the same protein family. A more robust approach is to use the sequence alignment that is created as part of the co-evolution prediction as your basis. You then identify the sequence that best represents the PDB-sequence of your homologous protein by performing N global sequence alignments (where N is the number of sequences in your MSA), one per entry of the MSA. The highest scoring alignment can then be used to map the indexing. This approach is robust enough that if your homologous PDB-sequence of interest was not present in the original MSA for whatever reason, you should still get a sensible mapping at the end (all limitations of sequence alignment considered).

One final consideration should be brought to the reader’s attention. What happens if, using the sequence as a starting point, one obtains one or more (i,j) pairs where either i or j is not resolved/present in the protein structure? For validation purposes, often these pairs are disregards. Yet, what does this co-evolutionary signal tell us about the missing residues in the structure? Are they disordered/flexible? Could the co-evolution help us identify low occupancy conformations?

I’ll leave the reader with these questions to digest. I hope this post proves helpful to those braving the seas of “sequence hell” in the near future.

Interactive Illustration of Collaboration Networks with D3

D3 is a JavaScript Library that allows the creation of interactive data visualisations. D3 stands for Data-Driven Documents and its advantage is that it is using internet standards as HTML, CSS, and SVG as the foundation. This gives maximal compatibility across all moderns browsers. It is widely used by journalists, data scientists, and starts to be used by academic scientists, too.

Here I want to present a simple way of creating interactive illustrations of collaboration networks, e.g., for your own website. Before going into details, have a look at the example below, it presents some of Rosalind Franklin’s papers and her co-authors.

[d3-source canvas=”wpd3-3903-2″]

The network illustration is a so-called bipartite network because it consists of two types of nodes, blue nodes represent scientists and orange nodes represent publications. These nodes are connected if a scientist is an author on a publication. This way of presenting is a so-called force layout, which simulates repelling Coulomb forces between all nodes and spring-like attractive forces act on nodes that are connected via links. You can drag the nodes around and explore the behaviour of the network.

You will have noticed that you can also see the name of the publications and co-authors when you hover over the nodes. For some of them, a representative figure or photograph is shown, too. You can also double-click the nodes and will be directed to the webpage of the publication or author.

For larger collaboration networks the visualisation is still possible but might get a bit messy. Thus, not showing any figures is advised. Furthermore, the name of the nodes should be shown either below the illustration or as a tooltip (the later is not possible in WordPress but on normal web pages as here). The illustration below shows all 124 publications written by OPIG, together with the 310 authors. Here, I had to remove the Head of the Group Charlotte Deane, as she is on almost all of these papers and would clutter the illustration, unfortunately. In network science, we call such a node an ego node.

[d3-source canvas=”wpd3-3903-0″]

If you want to play around with this, check out my Github repository. The creation of the network is fairly simple. You only need a Bibtex file and can then execute a Python script that creates a JSON file that is read into the JavaSript. This can then be incorporated in all web pages easily.

PS: To enable D3 in WordPress you need a special plugin.  Apparently, it is not up to date with the current stable D3 version 4 but you can load any missing functions manually.

Crystallographic programming: Super short tour of the cctbx

Two of the leading packages in crystallography are Phenix and CCP4. For most practicing crystallographers they will interact via with these to progress a single crystallographic data-set from diffraction images, through integration, merging, phasing, model building and hopefully deposition.

However, if you want to develop crystallographic software, you will likely need to decide on a framework to build upon. Phenix is built on the comprehensive cctbx library, whereas CCP4 programs are typically standlone, although common crystallographic libraries such as clipper and cctbx are utilised.

CCTBX is written mainly in python, with core crystallographic functionality written in C++. My usual starting place for understanding functionality is through the pdb parser tutorial. This introduces the concept of a hierarchy, a iterative way to represent a macromolecule:

from iotbx.pdb import hierarchy
pdb_in = hierarchy.input(file_name="model.pdb")
for chain in pdb_in.hierarchy.only_model().chains() :
  for residue_group in chain.residue_groups() :
    for atom_group in residue_group.atom_groups() :
      for atom in atom_group.atoms() :
        if (atom.element.strip().upper() == "ZN") :
          atom_group.remove_atom(atom)
      if (atom_group.atoms_size() == 0) :
        residue_group.remove_atom_group(atom_group)
    if (residue_group.atom_groups_size() == 0) :
      chain.remove_residue_group(residue_group)
f = open("model_Zn_free.pdb", "w")
f.write(pdb_in.hierarchy.as_pdb_string(
  crystal_symmetry=pdb_in.input.crystal_symmetry()))
f.close()

Although there are many ways to parse a pdb file, the introduction to iotbx.pdb, gives a view of how xray structure data can be associated to the model. The tour of the cctbx can be helpful starting place, especially for understanding how the python and c++ functionality interact through boost and the scitbx.array_family.flex. Unfortunately, documentation on cctbx tends to vary in quality and quantity throughout the modules:

Other components of the library include ways to simulate crystallographic data through simtbx,  and tools for processing xfel data.

As the library is open source, github hosted source code allows exploration of previously written routines, which can be very helpful for understanding the inner workings of the library. Note that there are also bulletin boards for users and developers of phenix and cctbx respectively. A few tutorials can also be found.

Hopefully this post will give someone other than me a reminder of where to find resources to get started developing within CCTBX.

Latexing with gvim

Here I’ll share my set-up for writing Latex with gvim instead of a separate Latex editor. If you are text-editor averse, this blog post is not for you. But if, like me, you love vim and hate useless GUIs, this might be helpful.

We’re lucky to have nice big screens in the Stats Department, but I tend to prefer writing on my MacBook (I find it’s easier to transport to e.g. a cafe, my home, etc). Until now, I’ve been happily using TexMaker for writing, but during a recent period of intense Latexing I started to find the useable screen space oppressively small. The unnecessary GUI had to go.   

No offence TexMaker but I don’t like you

One of our good friends in Statistical Genetics recommended some things to help me with the transition to just using good old (g)vim, which I will now recommend to you.

The key thing is the LaTex-Box plug-in for vim, which gives you the compilation commands, as well as the essentials such as smart indentation, highlight matching, command completion, etc. I used pathogen to install it (see the GitHub for instructions).

Of course, you can then customise your .vimrc file to add more helpful things. This can be the simple preferences, such as using a light background when using gvim:

 

if has(“gui_running”)

        set background=light

endif

You can also do more complicated magic like tabbing through available commands, and the ability to minimise sections, etc. Sidenote: to make working with paragraphs easier, I recommend setting the up/down arrows to move the cursor to the next line in the GUI rather than the next actual line. I prefer overriding this behaviour only in gvim, while leaving the normal behaviour in vim (for actual coding). But each to their own.

To get started, open a .tex file, then compile and view the document with the command Latexmk.

Command suggestions are an example of a magical feature added in .vimrc

The configurations for this command are set in the file .latexmkrc. Mine looks like this:

 

$recorder = 1;
$pdf_mode = 1;
$bibtex_use = 2;
$pdflatex = "pdflatex --shell-escape %O %S";
$pdf_previewer = "start open -a skim %O %S";

My pdf viewer of choice on Mac is Skim, which autoupdates. I view the source and preview at the same time using split view. Please admire the beauty below:

Wow what a beautiful screen

My favourite part is that whenever you save (w), it recompiles and updates the preview. As someone who accidentally types :w everywhere that isn’t vim, it’s nice that this is now productive. It also recompiles automatically if the .bib file is updated. Note that if you have errors at compilation (I’m sure you don’t), you can view them with the command LatexErrors.

Now you too can be a (nearly) GUI-free lightweight Latexer. Enjoy!

 

Drawing Networks in LaTeX with tikz-network

While researching on protein interaction networks it is often important to illustrate networks. For this many different tools are available, for example, Python’s NetworkX and Matlab, that allow the export of figures as pixelated images or vector graphics. Usually, these figures are then incorporated in the papers, which are commonly written in LaTeX. In this post, I want to present `tikz-network’, which is a novel tool to code and illustrate networks directly in LaTeX.

To create an illustration you define the network’s nodes with their positions and edges between these nodes. An example of a simple network is

\begin{tikzpicture}
   \Vertex[color = blue]{A}
   \Vertex[x=3,y=1,color=red]{B}
   \Vertex[x=0,y=2,color=orange]{C}
   \Edge[lw=5pt](A)(B)
   \Edge[lw=3pt,bend=15,Direct](A)(C)
\end{tikzpicture}

The illustrations can be much more complex and allow dashed lines, opacity, and many other features. Importantly, the properties do not need to be specified in the LaTeX file itself but can also be saved in an external file and imported with the  \Vertices{data/vertices.csv}command. This allows the representation of more complex networks, for example the multilayer network below is created from the two files, the first representing the nodes

id, x, y ,size, color,opacity,label,layer 
A, 0, 0, .4 , green, .9 , a , 1
B, 1, .7, .6 , , .5 , b , 1
C, 2, 1, .8 ,orange, .3 , c , 1
D, 2, 0, .5 , red, .7 , d , 2
E,.2,1.5, .5 , gray, , e , 1
F,.1, .5, .7 , blue, .3 , f , 2
G, 2, 1, .4 , cyan, .7 , g , 2
H, 1, 1, .4 ,yellow, .7 , h , 2

and the second having the edge information:

u,v,label,lw,color ,opacity,bend,Direct
A,B, ab  ,.5,red   ,   1   ,  30,false
B,C, bc  ,.7,blue  ,   1   , -60,false
A,E, ae  , 1,green ,   1   ,  45,true
C,E, ce  , 2,orange,   1   ,   0,false
A,A, aa  ,.3,black ,  .5   ,  75,false
C,G, cg  , 1,blue  ,  .5   ,   0,false
E,H, eh  , 1,gray  ,  .5   ,   0,false
F,A, fa  ,.7,red   ,  .7   ,   0,true
D,F, df  ,.7,cyan  ,   1   ,   30,true
F,H, fh  ,.7,purple,   1   ,   60,false
D,G, dg  ,.7,blue  ,  .7   ,   60,false

For details, please see the extensive manual on the GitHub page of the project. It is a very new project and I only started using it but I like it so far for a couple of reasons:

  • it is easy to use, especially for small example graphs
  • the multilayer functionality is very convenient
  • included texts are automatically in the correct size and font with the rest of the LaTeX document
  • it can be combined with regular tikz commands to create more complex illustrations

Using Random Forests in Python with Scikit-Learn

I spend a lot of time experimenting with machine learning tools in my research; in particular I seem to spend a lot of time chasing data into random forests and watching the other side to see what comes out. In my many hours of Googling “random forest foobar” a disproportionate number of hits offer solutions implemented in R. As a young Pythonista in the present year I find this a thoroughly unacceptable state of affairs, so I decided to write a crash course in how to build random forest models in Python using the machine learning library scikit-learn (or sklearn to friends). This is far from exhaustive, and I won’t be delving into the machinery of how and why we might want to use a random forest. Rather, the hope is that this will be useful to anyone looking for a hands-on introduction to random forests (or machine learning in general) in Python.

In the future I’ll write a more in-depth post on how a few libraries turn Python into a powerful environment for data handling and machine learning. Until then, though, let’s jump into random forests!

Toy datasets

Sklearn comes with several nicely formatted real-world toy data sets which we can use to experiment with the tools at our disposal. We’ll be using the venerable iris dataset for classification and the Boston housing set for regression. Sklearn comes with a nice selection of data sets and tools for generating synthetic data, all of which are well-documented. Now, let’s write some Python!

import numpy as np
import pandas as pd
import matplotlib.pyplot as plt
import seaborn as sns

from sklearn import datasets
iris = datasets.load_iris()

Classification using random forests

First we’ll look at how to do solve a simple classification problem using a random forest. The iris dataset is probably the most widely-used example for this problem and nicely illustrates the problem of classification when some classes are not linearly separable from the others.

First we’ll load the iris dataset into a pandas dataframe. Pandas is a nifty Python library which provides a data structure comparable to the dataframes found in R with database style querying. As an added bonus, the seaborn visualization library integrates nicely with pandas allowing us to generate a nice scatter matrix of our data with minimal fuss.

df = pd.DataFrame(iris.data, columns=iris.feature_names)

# sklearn provides the iris species as integer values since this is required for classification
# here we're just adding a column with the species names to the dataframe for visualisation
df['species'] = np.array([iris.target_names[i] for i in iris.target])

sns.pairplot(df, hue='species')

Neat. Notice that iris-setosa is easily identifiable by petal length and petal width, while the other two species are much more difficult to distinguish. We could do all sorts of pre-processing and exploratory analysis at this stage, but since this is such a simple dataset let’s just fire on. We’ll do a bit of pre-processing later when we come to the Boston data set.

First, let’s split the data into training and test sets. We’ll used stratified sampling by iris class to ensure both the training and test sets contain a balanced number of representatives of each of the three classes. Sklearn requires that all features and targets be numeric, so the three classes are represented as integers (0, 1, 2). Here we’re doing a simple 50/50 split because the data are so nicely behaved. Typically however we might use a 75/25 or even 80/20 training/test split to ensure we have enough training data. In true Python style this is a one-liner.

from sklearn.model_selection import train_test_split

X_train, X_test, y_train, y_test = train_test_split(df[iris.feature_names], iris.target, test_size=0.5, stratify=iris.target, random_state=123456)

Now let’s fit a random forest classifier to our training set. For the most part we’ll use the default settings since they’re quite robust. One exception is the out-of-bag estimate: by default an out-of-bag error estimate is not computed, so we need to tell the classifier object that we want this.

If you’re used to the R implementation, or you ever find yourself having to compare results using the two, be aware that some parameter names and default settings are different between the two. Fortunately both have excellent documentation so it’s easy to ensure you’re using the right parameters if you ever need to compare models.

from sklearn.ensemble import RandomForestClassifier

rf = RandomForestClassifier(n_estimators=100, oob_score=True, random_state=123456)
rf.fit(X_train, y_train)

Let’s see how well our model performs when classifying our unseen test data. For a random forest classifier, the out-of-bag score computed by sklearn is an estimate of the classification accuracy we might expect to observe on new data. We’ll compare this to the actual score obtained on our test data.

from sklearn.metrics import accuracy_score

predicted = rf.predict(X_test)
accuracy = accuracy_score(y_test, predicted)

print(f'Out-of-bag score estimate: {rf.oob_score_:.3}')
print(f'Mean accuracy score: {accuracy:.3}')
Out-of-bag score estimate: 0.973
Mean accuracy score: 0.933

Not bad. However, this doesn’t really tell us anything about where we’re doing well. A useful technique for visualising performance is the confusion matrix. This is simply a matrix whose diagonal values are true positive counts, while off-diagonal values are false positive and false negative counts for each class against the other.

from sklearn.metrics import confusion_matrix

cm = pd.DataFrame(confusion_matrix(y_test, predicted), columns=iris.target_names, index=iris.target_names)
sns.heatmap(cm, annot=True)

This lets us know that our model correctly separates the setosa examples, but exhibits a small amount of confusion when attempting to distinguish between versicolor and virginica.

Random forest regression

Now let’s look at using a random forest to solve a regression problem. The Boston housing data set consists of census housing price data in the region of Boston, Massachusetts, together with a series of values quantifying various properties of the local area such as crime rate, air pollution, and student-teacher ratio in schools. The question for us is whether we can use these data to accurately predict median house prices. One caveat of this data set is that the median house price is truncated at $50,000 which suggests that there may be considerable noise in this region of the data. You might want to remove all data with a median house price of $50,000 from the set and see if the regression improves at all.

As before we’ll load the data into a pandas dataframe. This time, however, we’re going to do some pre-processing of our data by independently transforming each feature to have zero mean and unit variance. The values of different features vary greatly in order of magnitude. If we were to analyse the raw data as-is, we run the risk of our analysis being skewed by certain features dominating the variance. This isn’t strictly necessary for a random forest, but will enable us to perform a more meaningful principal component analysis later. Performing this transformation in sklearn is super simple using the StandardScaler class of the preprocessing module. This time we’re going to use an 80/20 split of our data. You could bin the house prices to perform stratified sampling, but we won’t worry about that for now.

boston = datasets.load_boston()

features = pd.DataFrame(boston.data, columns=boston.feature_names)
targets = boston.target

As before, we’ve loaded our data into a pandas dataframe. Notice how I have to construct new dataframes from the transformed data. This is because sklearn is built around numpy arrays. While it’s possible to return a view of a dataframe as an array, transforming the contents of a dataframe requires a little more work. Of course, there’s a library for that, but I’m lazy so I didn’t use it this time.

from sklearn.preprocessing import StandardScaler

X_train, X_test, y_train, y_test = train_test_split(features, targets, train_size=0.8, random_state=42)

scaler = StandardScaler().fit(X_train)
X_train_scaled = pd.DataFrame(scaler.transform(X_train), index=X_train.index.values, columns=X_train.columns.values)
X_test_scaled = pd.DataFrame(scaler.transform(X_test), index=X_test.index.values, columns=X_test.columns.values)

With the data standardised, let’s do a quick principal-component analysis to see if we could reduce the dimensionality of the problem. This is quick and easy in sklearn using the PCA class of the decomposition module.

from sklearn.decomposition import PCA

pca = PCA()
pca.fit(X_train)
cpts = pd.DataFrame(pca.transform(X_train))
x_axis = np.arange(1, pca.n_components_+1)
pca_scaled = PCA()
pca_scaled.fit(X_train_scaled)
cpts_scaled = pd.DataFrame(pca.transform(X_train_scaled))

# matplotlib boilerplate goes here

Notice how without data standardisation the variance is completely dominated by the first principal component. With standardisation, however, we see that in fact we must consider multiple features in order to explain a significant proportion of the variance. You might want to experiment with building regression models using the principal components (or indeed just combinations of the raw features) to see how well you can do with less information. For now though we’re going to use all of the (scaled) features as the regressors for our model. As with the classification problem fitting the random forest is simple using the RandomForestRegressor class.

from sklearn.ensemble import RandomForestRegressor

rf = RandomForestRegressor(n_estimators=500, oob_score=True, random_state=0)
rf.fit(X_train, y_train)

Now let’s see how we do on our test set. As before we’ll compare the out-of-bag estimate (this time it’s an R-squared score) to the R-squared score for our predictions. We’ll also compute Spearman rank and Pearson correlation coefficients for our predictions to get a feel for how we’re doing.

from sklearn.metrics import r2_score
from scipy.stats import spearmanr, pearsonr

predicted_train = rf.predict(X_train)
predicted_test = rf.predict(X_test)

test_score = r2_score(y_test, predicted_test)
spearman = spearmanr(y_test, predicted_test)
pearson = pearsonr(y_test, predicted_test)

print(f'Out-of-bag R-2 score estimate: {rf.oob_score_:>5.3}')
print(f'Test data R-2 score: {test_score:>5.3}')
print(f'Test data Spearman correlation: {spearman[0]:.3}')
print(f'Test data Pearson correlation: {pearson[0]:.3}')
Out-of-bag R-2 score estimate: 0.841
Test data R-2 score: 0.886
Test data Spearman correlation: 0.904
Test data Pearson correlation: 0.942

Not too bad, though there are a few outliers that would be worth looking into. Your challenge, should you choose to accept it, is to see if removing the $50,000 data improves the regression.

Wrapping up

Congratulations on making it this far. Now you know how to pre-process your data and build random forest models all from the comfort of your iPython session. I plan on writing more in the future about how to use Python for machine learning, and in particular how to make use of some of the powerful tools available in sklearn (a pipeline for data preparation, model fitting, prediction, in one line of Python? Yes please!), and how to make sklearn and pandas play nicely with minimal hassle. If you’re lucky, and if I can bring myself to process the data nicely, I might include some fun examples from less well-behaved real-world data sets.

Until then, though, happy Pythoning!

A very basic introduction to Random Forests using R

Random Forests is a powerful tool used extensively across a multitude of fields. As a matter of fact, it is hard to come upon a data scientist that never had to resort to this technique at some point. Motivated by the fact that I have been using Random Forests quite a lot recently, I decided to give a quick intro to Random Forests using R.

So what are Random Forests?  Well, I am probably not the most suited person to answer this question (a google search will reveal much more interesting answers) , still I shall give it a go. Random Forests is a learning method for classification (and others applications — see below). It is based on generating a large number of decision trees, each constructed using a different subset of your training set. These subsets are usually selected by sampling at random and with replacement from the original data set. The decision trees are then used to identify a classification consensus by selecting the most common output (mode). While random forests can be used for other applications (i.e. regression), for the sake of keeping this post short, I shall focus solely on classification.

Why R? Well, the quick and easy question for this is that I do all my plotting in R (mostly because I think ggplot2 looks very pretty). I decided to explore Random Forests in R and to assess what are its advantages and shortcomings. I am planning to compare Random Forests in R against the python implementation in scikit-learn. Do expect a post about this in the near future!

The data: to keep things simple, I decided to use the Edgar Anderson’s Iris Data set. You can have a look at it by inspecting the contents of iris in R. This data set contains observations for four features (sepal length and width, and petal length and width – all in cm) of 150 flowers, equally split between three different iris species. This data set is fairly canon in classification and data analysis. Let us take a look at it, shall we:

As you can observe, there seems to be some separation in regards to the different features and our three species of irises [note: this set is not very representative of a real world data set and results should be taken with a grain of salt].

Training and Validation sets: great care needs to be taken to ensure clear separation between training and validation sets. I tend to save the cases for which I am actually interested in performing predictions as a second validation set (Validation 2). Then I split the remaining data evenly into Training and Validation 1.

Let us split our data set then, shall we?

# Set random seed to make results reproducible:
set.seed(17)
# Calculate the size of each of the data sets:
data_set_size <- floor(nrow(iris)/2)
# Generate a random sample of "data_set_size" indexes
indexes <- sample(1:nrow(iris), size = data_set_size)

# Assign the data to the correct sets
training <- iris[indexes,]
validation1 <- iris[-indexes,]

Before we can move on, here are some things to consider:

1- The size of your data set usually imposes a hard limit on how many features you can consider. This occurs due to the curse of dimensionality, i.e. your data becomes sparser and sparser as you increase the number of features considered, which usually leads to overfitting. While there is no rule of thumb relating to how many features vs.  the number of observations you should use, I try to keep e^Nf < No (Nf = number of features, No = number of observations) to minimise overfitting [this is not always possible and it does not ensure that we won’t overfit]. In this case, our training set has 75 observations, which suggests that using four features (e^4 ~ 54.6) is not entirely absurd. Obviously, this depends on your data, so we will cover some further overfitting checks later on.

2- An important thing to consider when assembling training sets is the proportion of negatives vs. positives in your data. Think of an extreme scenario where you have many, many more observations for one class vs. the others. How will this affect classification? This would make it more likely for the classifier to predict the dominant class when given new values. I mentioned before that the iris set is quite nice to play with. It comes with exactly 50 observations for each species of irises. What happens if you have a data set with a much higher number of observations for a particular class? You can bypass any imbalance regarding the representation of each class by carefully constructing your training set in order not to favour any particular class. In this case, our randomly selected set has 21 observations for species setosa and 27 observations for each of species versicolor and virginica, so we are good to go.

3- Another common occurrence that is not represented by the iris data set is missing values (NAs) for observations. There are many ways of dealing with missing values, including assigning the median or the mode for that particular feature to the missing observation or even disregarding some observations entirely, depending on how many observations you have. There are even ways to use random forests to estimate a good value to assign to the missing observations, but for the sake of brevity, this will not be covered here.

Right, data sets prepared and no missing values, it is time to fire our random forests algorithm. I am using the  randomForest package. You can click the link for additional documentation. Here is the example usage code:

#import the package
library(randomForest)
# Perform training:
rf_classifier = randomForest(Species ~ ., data=training, ntree=100, mtry=2, importance=TRUE)

Note some important parameters:

-The first parameter specifies our formula: Species ~ . (we want to predict Species using each of the remaining columns of data).
ntree defines the number of trees to be generated. It is typical to test a range of values for this parameter (i.e. 100,200,300,400,500) and choose the one that minimises the OOB estimate of error rate.
mtry is the number of features used in the construction of each tree. These features are selected at random, which is where the “random” in “random forests” comes from. The default value for this parameter, when performing classification, is sqrt(number of features).
importance enables the algorithm to calculate variable importance.

We can quickly look at the results of our classifier for our training set by printing the contents of rf_classifier:

> rf_classifier

Call:
 randomForest(formula = Species ~ ., data = training,ntree=100,mtry=2, importance = TRUE) 
               Type of random forest: classification
                     Number of trees: 100
No. of variables tried at each split: 2

        OOB estimate of  error rate: 5.33%
Confusion matrix:
           setosa versicolor virginica class.error
setosa         21          0         0  0.00000000
versicolor      0         25         2  0.07407407
virginica       0          2        25  0.07407407


As you can see, it lists the call used to build the classifier, the number of trees (100), the variables at each split (2), and it outputs a very useful confusion matrix and OOB estimate of error rate. This estimate is calculated by counting however many points in the training set were misclassified (2 versicolor and 2 virginica observations = 4) and dividing this number by the total number of observations (4/75 ~= 5.33%).

The OOB estimate of error rate is a useful measure to discriminate between different random forest classifiers. We could, for instance, vary the number of trees or the number of variables to be considered, and select the combination that produces the smallest value for this error rate. For more complicated data sets, i.e. when a higher number of features is present, a good idea is to use cross-validation to perform feature selection using the OOB error rate (see rfcv from randomForest for more details).

Remember the importance parameter? Let us take a look at the importance that our classifier has assigned to each variable:

varImpPlot(rf_classifier)

Each features’s importance is assessed based on two criteria:

-MeanDecreaseAccuracy: gives a rough estimate of the loss in prediction performance when that particular variable is omitted from the training set. Caveat: if two variables are somewhat redundant, then omitting one of them may not lead to massive gains in prediction performance, but would make the second variable more important.

-MeanDecreaseGini: GINI is a measure of node impurity. Think of it like this, if you use this feature to split the data, how pure will the nodes be? Highest purity means that each node contains only elements of a single class. Assessing the decrease in GINI when that feature is omitted leads to an understanding of how important that feature is to split the data correctly.

Do note that these measures are used to rank variables in terms of importance and, thus, their absolute values could be disregarded.

Ok, great. Looks like we have a classifier that was properly trained and is producing somewhat good predictions for our training set. Shall we evaluate what happens when we try to use this classifier to predict classes for our  validation1 set?

# Validation set assessment #1: looking at confusion matrix
prediction_for_table <- predict(rf_classifier,validation1[,-5])
table(observed=validation1[,5],predicted=prediction_for_table)

            predicted
observed     setosa versicolor virginica
  setosa         29          0         0
  versicolor      0         20         3
  virginica       0          1        22

The confusion matrix is a good way of looking at how good our classifier is performing when presented with new data.

Another way of assessing the performance of our classifier is to generate a ROC curve and compute the area under the curve:

 

# Validation set assessment #2: ROC curves and AUC

# Needs to import ROCR package for ROC curve plotting:
library(ROCR)

# Calculate the probability of new observations belonging to each class
# prediction_for_roc_curve will be a matrix with dimensions data_set_size x number_of_classes
prediction_for_roc_curve <- predict(rf_classifier,validation1[,-5],type="prob")

# Use pretty colours:
pretty_colours <- c("#F8766D","#00BA38","#619CFF")
# Specify the different classes 
classes <- levels(validation1$Species)
# For each class
for (i in 1:3)
{
 # Define which observations belong to class[i]
 true_values <- ifelse(validation1[,5]==classes[i],1,0)
 # Assess the performance of classifier for class[i]
 pred <- prediction(prediction_for_roc_curve[,i],true_values)
 perf <- performance(pred, "tpr", "fpr")
 if (i==1)
 {
     plot(perf,main="ROC Curve",col=pretty_colours[i]) 
 }
 else
 {
     plot(perf,main="ROC Curve",col=pretty_colours[i],add=TRUE) 
 }
 # Calculate the AUC and print it to screen
 auc.perf <- performance(pred, measure = "auc")
 print(auc.perf@y.values)
}

Here is the final product (ROC curve):

And here are the values for our AUCs:

Setosa
AUC = 1

Versicolor
AUC = 0.98

Virginica
AUC = 0.98

Voila! I hope this was somewhat useful!